# hmmscan :: search sequence(s) against a profile database # HMMER 3.4 (Aug 2023); http://hmmer.org/ # Copyright (C) 2023 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query sequence file: ../../../61.SPL_identification/03.gene_stat/Ft.SPL.pep.fasta # target HMM database: Pfam-A.hmm # output directed to file: results.out # per-seq hits tabular output: results.tblout # per-dom hits tabular output: results.domtblout # multithread parallelization: 8 workers # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: FtPinG0009145900.01.T01 [L=989] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.9e-41 139.6 1.4 1.3e-40 138.5 1.4 1.6 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 9.1e-30 103.3 16.2 1.9e-29 102.3 16.2 1.6 1 SBP SBP domain 0.00015 22.8 0.0 0.00067 20.7 0.0 2.1 1 Ank_2 Ankyrin repeats (3 copies) 0.00042 21.0 0.0 3.8 8.9 0.0 3.1 2 Ank_3 Ankyrin repeat 0.0015 19.2 0.1 2.6 9.1 0.0 2.9 2 Ank Ankyrin repeat 0.0028 18.4 0.0 27 5.8 0.0 3.9 3 Ank_4 Ankyrin repeats (many copies) ------ inclusion threshold ------ 0.026 15.4 0.0 14 6.7 0.0 2.8 2 Ank_5 Ankyrin repeats (many copies) 0.2 11.6 0.0 0.48 10.4 0.0 1.5 1 RYDR_ITPR RIH domain Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 138.5 1.4 4.2e-44 1.3e-40 2 113 .] 557 669 .. 556 669 .. 0.95 Alignments for each domain: == domain 1 score: 138.5 bits; conditional E-value: 4.2e-44 Ig_SPL7 2 eekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslseedtvkdeeeelqklkfscs.epnvlGrgFi 86 +++++++lsV+P+av +++ v+f vkGsnLs+++trllc++eGkYl+qe+ ++l+++++ + e++e+++++fscs p+v+GrgFi FtPinG0009145900.01.T01 557 SSCCSRILSVTPIAVCMSELVQFQVKGSNLSRSSTRLLCAIEGKYLAQEAHQDLTTDSDSCMEDNEIECVNFSCSaVPSVTGRGFI 642 56899***************************************************96666778**********8359******** PP Ig_SPL7 87 EVEneglssnffPvivadkeiCsElrl 113 EVE++glss+ffP+i+a+k++CsE+r+ FtPinG0009145900.01.T01 643 EVEDNGLSSSFFPFIIAEKDVCSEIRM 669 *************************97 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.3 16.2 5.9e-33 1.9e-29 1 74 [. 137 210 .. 137 211 .. 0.99 Alignments for each domain: == domain 1 score: 102.3 bits; conditional E-value: 5.9e-33 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC +dls+ak+yhrrhkvCe H+ka++ +v ++ qRfCqqCsrfh l+eFd+ krsCr+rLa+hn+rrrk FtPinG0009145900.01.T01 137 CQVEGCCVDLSNAKDYHRRHKVCELHSKATKALVGNVMQRFCQQCSRFHFLKEFDEGKRSCRRRLAGHNKRRRK 210 *************************************************************************8 PP >> Ank_2 Ankyrin repeats (3 copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 20.7 0.0 2.1e-07 0.00067 1 77 [. 773 872 .. 773 880 .. 0.76 Alignments for each domain: == domain 1 score: 20.7 bits; conditional E-value: 2.1e-07 Ank_2 1 LmlAakngnlelvklLl..eg............adanlqdkngetaLhlAaknghleiv.klLle....hgad...vn.dnngrta 63 L+ A+++++ +lv++Ll + ++++ + g t+Lh+Aa ++ e+v +L + g++ + d++g t+ FtPinG0009145900.01.T01 773 LHRAVRRNSRSLVEFLLryVHvssseelsesflFRPDVKGPAGLTPLHIAAGTDDSEAVlDALTDdpgkVGIQawkTArDSTGSTP 858 8*******99*******753366666666655544566666*************9999779999966542222443226899**** PP Ank_2 64 LhyAaesghleivk 77 yA gh+ + FtPinG0009145900.01.T01 859 EDYARLRGHYSYIH 872 ****9999988776 PP >> Ank_3 Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.9 0.0 0.0012 3.8 5 23 .. 772 790 .. 769 795 .. 0.90 2 ! 8.6 0.0 0.0015 4.9 2 23 .. 815 837 .. 814 842 .. 0.86 Alignments for each domain: == domain 1 score: 8.9 bits; conditional E-value: 0.0012 Ank_3 5 pLhlAarngrleivklLle 23 +Lh A+r ++ +v++Ll+ FtPinG0009145900.01.T01 772 LLHRAVRRNSRSLVEFLLR 790 8*****************9 PP == domain 2 score: 8.6 bits; conditional E-value: 0.0015 Ank_3 2 gntpLhlAarngrle.ivklLle 23 g tpLh+Aa ++ e ++++L + FtPinG0009145900.01.T01 815 GLTPLHIAAGTDDSEaVLDALTD 837 88************988888876 PP >> Ank Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 6.9 0.0 0.0041 13 6 23 .. 773 790 .. 771 797 .. 0.87 2 ! 9.1 0.0 0.00081 2.6 2 18 .. 815 831 .. 814 841 .. 0.76 Alignments for each domain: == domain 1 score: 6.9 bits; conditional E-value: 0.0041 Ank 6 LHlAaraghlevvklLLk 23 LH A+r+++ ++v++LL+ FtPinG0009145900.01.T01 773 LHRAVRRNSRSLVEFLLR 790 9*****9**********4 PP == domain 2 score: 9.1 bits; conditional E-value: 0.00081 Ank 2 GnTPLHlAaraghlevv 18 G TPLH+Aa ++ e v FtPinG0009145900.01.T01 815 GLTPLHIAAGTDDSEAV 831 89*******65664443 PP >> Ank_4 Ankyrin repeats (many copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.8 0.0 0.0084 27 31 50 .] 770 789 .. 725 789 .. 0.91 2 ! 5.6 0.0 0.0097 31 28 46 .. 814 831 .. 798 835 .. 0.78 3 ? 2.1 0.0 0.13 4e+02 21 48 .. 844 873 .. 840 874 .. 0.82 Alignments for each domain: == domain 1 score: 5.8 bits; conditional E-value: 0.0084 Ank_4 31 etaLhfAasngnlevlklLl 50 + Lh+A+++++ + +++Ll FtPinG0009145900.01.T01 770 MGLLHRAVRRNSRSLVEFLL 789 668****************7 PP == domain 2 score: 5.6 bits; conditional E-value: 0.0097 Ank_4 28 gngetaLhfAasngnlevl 46 g t+Lh+Aa + e++ FtPinG0009145900.01.T01 814 A-GLTPLHIAAGTDDSEAV 831 4.9********99988876 PP == domain 3 score: 2.1 bits; conditional E-value: 0.13 Ank_4 21 adinat..dgngetaLhfAasngnlevlkl 48 ++ ++t d g t+ ++A ++g+++ ++l FtPinG0009145900.01.T01 844 IQAWKTarDSTGSTPEDYARLRGHYSYIHL 873 55566666999**************99875 PP >> Ank_5 Ankyrin repeats (many copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.3 0.0 0.012 39 20 36 .. 773 789 .. 769 796 .. 0.90 2 ? 6.7 0.0 0.0043 14 12 32 .. 811 831 .. 804 839 .. 0.84 Alignments for each domain: == domain 1 score: 5.3 bits; conditional E-value: 0.012 Ank_5 20 LhvAakygaleivrlLl 36 Lh A+++++ +v++Ll FtPinG0009145900.01.T01 773 LHRAVRRNSRSLVEFLL 789 9**************** PP == domain 2 score: 6.7 bits; conditional E-value: 0.0043 Ank_5 12 ldgegytpLhvAakygaleiv 32 + g tpLh+Aa ++ +e v FtPinG0009145900.01.T01 811 KGPAGLTPLHIAAGTDDSEAV 831 566789*********999988 PP >> RYDR_ITPR RIH domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 10.4 0.0 0.00015 0.48 69 154 .. 221 303 .. 197 308 .. 0.84 Alignments for each domain: == domain 1 score: 10.4 bits; conditional E-value: 0.00015 RYDR_ITPR 69 elseekeeswkeilrlcyrlLaalirdnrkNqeaiakhldfllsqlgsdelaeglLdvltavlmdnreLllkyikekeiesfisLl 154 +++e++ + il ++ r+L + ++nr+ +a ++ + +ll+ l+s+ + g d l+ +++++++Ll + i+ + e+ L+ FtPinG0009145900.01.T01 221 PANDEQA--NNYILMSLMRILSNMHTNNRSDPAADHELVAHLLRSLASQPGSPGFND-LAGLVHESQKLLNSGITGGNTEKLSALM 303 3444444..468****************************************99998.6789**********9*999999888887 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (989 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 957 (0.0374633); expected 510.9 (0.02) Passed bias filter: 721 (0.0282247); expected 510.9 (0.02) Passed Vit filter: 68 (0.00266197); expected 25.5 (0.001) Passed Fwd filter: 8 (0.000313173); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 8 [number of targets reported over threshold] # CPU time: 1.71u 0.81s 00:00:02.52 Elapsed: 00:00:01.84 # Mc/sec: 2184.64 // Query: FtPinG0007295700.01.T01 [L=337] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.3e-32 109.8 12.7 1.2e-31 109.3 12.7 1.2 1 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.3 12.7 4.8e-36 1.2e-31 1 74 [. 67 140 .. 67 141 .. 0.99 Alignments for each domain: == domain 1 score: 109.3 bits; conditional E-value: 4.8e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC++dl++ak+y+ rhkvC +H+k+++v+v+g+eqRfCqqCsrfh+l eFd+ krsCr+rLa+hnerrrk FtPinG0007295700.01.T01 67 CQVEGCDIDLTDAKAYYSRHKVCCMHSKSSKVTVAGIEQRFCQQCSRFHQLGEFDHGKRSCRRRLAGHNERRRK 140 *************************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (337 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 654 (0.0256019); expected 510.9 (0.02) Passed bias filter: 418 (0.0163633); expected 510.9 (0.02) Passed Vit filter: 37 (0.00144842); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.65u 0.78s 00:00:02.42 Elapsed: 00:00:01.76 # Mc/sec: 780.73 // Query: FtPinG0008190500.01.T01 [L=401] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-30 105.7 18.5 2.3e-30 105.2 18.5 1.3 1 SBP SBP domain ------ inclusion threshold ------ 3.4 8.5 8.0 0.19 12.5 2.4 1.7 2 Chitin_bind_1 Chitin recognition protein Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.2 18.5 1.8e-34 2.3e-30 1 74 [. 138 211 .. 138 212 .. 0.99 Alignments for each domain: == domain 1 score: 105.2 bits; conditional E-value: 1.8e-34 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC+ dlssak+yhr+h+vCe+H+k ++vv+ g+e RfCqqCsrfh+lseFd++krsCrkrL++hn+rrrk FtPinG0008190500.01.T01 138 CQVEGCDLDLSSAKDYHRKHRVCETHSKCSKVVICGVERRFCQQCSRFHSLSEFDQKKRSCRKRLSDHNARRRK 211 *************************************************************************8 PP >> Chitin_bind_1 Chitin recognition protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.9 0.3 2 2.6e+04 29 34 .. 137 143 .. 136 144 .. 0.65 2 ? 12.5 2.4 1.5e-05 0.19 7 32 .. 156 181 .. 152 186 .. 0.86 Alignments for each domain: == domain 1 score: -3.9 bits; conditional E-value: 2 Chitin_bind_1 29 yCgk.gC 34 +C+ gC FtPinG0008190500.01.T01 137 HCQVeGC 143 6766666 PP == domain 2 score: 12.5 bits; conditional E-value: 1.5e-05 Chitin_bind_1 7 ggakCpnnlCCSqyGyCGttsdyCgk 32 ++++C+++ CS+ CG++ +C++ FtPinG0008190500.01.T01 156 KHRVCETHSKCSKVVICGVERRFCQQ 181 5679********************65 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (401 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 949 (0.0371501); expected 510.9 (0.02) Passed bias filter: 491 (0.019221); expected 510.9 (0.02) Passed Vit filter: 29 (0.00113525); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.53u 0.71s 00:00:02.24 Elapsed: 00:00:01.67 # Mc/sec: 973.88 // Query: FtPinG0000496000.01.T01 [L=255] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.9e-32 110.1 14.3 1.2e-31 109.3 14.3 1.4 1 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.3 14.3 4.7e-36 1.2e-31 1 74 [. 21 94 .. 21 95 .. 0.99 Alignments for each domain: == domain 1 score: 109.3 bits; conditional E-value: 4.7e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 C vdgC+ dls+ ++yhrrhkvCe H+k+++v+++g+eqRfCqqCsrfh+l eFd+ krsCrkrL++hn+rrrk FtPinG0000496000.01.T01 21 CLVDGCKSDLSKCRDYHRRHKVCELHSKTPKVTIAGREQRFCQQCSRFHSLGEFDEGKRSCRKRLEGHNRRRRK 94 9************************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (255 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 763 (0.0298689); expected 510.9 (0.02) Passed bias filter: 379 (0.0148366); expected 510.9 (0.02) Passed Vit filter: 29 (0.00113525); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.30u 0.72s 00:00:02.02 Elapsed: 00:00:01.65 # Mc/sec: 629.26 // Query: FtPinG0000493400.01.T01 [L=428] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-30 105.7 15.3 1.6e-30 105.7 15.3 2.0 2 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 105.7 15.3 6.4e-35 1.6e-30 1 74 [. 161 234 .. 161 235 .. 0.99 2 ? -1.1 0.0 0.13 3.3e+03 19 33 .. 305 319 .. 297 325 .. 0.74 Alignments for each domain: == domain 1 score: 105.7 bits; conditional E-value: 6.4e-35 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC+ dlssak+yhr+h+vC++H+k+++vv+ g e RfCqqCsrfh+ls+Fd++krsCr+rL++hn+rrrk FtPinG0000493400.01.T01 161 CQVEGCNLDLSSAKDYHRKHRVCANHSKSPKVVICGLERRFCQQCSRFHNLSDFDHKKRSCRRRLSDHNARRRK 234 *************************************************************************8 PP == domain 2 score: -1.1 bits; conditional E-value: 0.13 SBP 19 rhkvCeeHakaesvv 33 h +C+eH +++ + FtPinG0000493400.01.T01 305 HHVTCNEHQETKFKL 319 5778****9987655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (428 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 989 (0.038716); expected 510.9 (0.02) Passed bias filter: 574 (0.0224702); expected 510.9 (0.02) Passed Vit filter: 40 (0.00156586); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.78u 0.77s 00:00:02.54 Elapsed: 00:00:01.79 # Mc/sec: 972.83 // Query: FtPinG0001782200.01.T01 [L=412] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6e-30 103.8 14.1 1e-29 103.1 14.1 1.4 1 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.1 14.1 4e-34 1e-29 1 74 [. 122 195 .. 122 196 .. 0.99 Alignments for each domain: == domain 1 score: 103.1 bits; conditional E-value: 4e-34 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC+ dlss k yhr+h+vC +H+k+++v+++g e RfCqqCsrfh+lseFd++krsCr+rL +hn+rrrk FtPinG0001782200.01.T01 122 CQVEGCNLDLSSDKVYHRKHRVCVTHSKSSKVIIRGLERRFCQQCSRFHNLSEFDQKKRSCRRRLLDHNARRRK 195 *************************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (412 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 835 (0.0326874); expected 510.9 (0.02) Passed bias filter: 570 (0.0223136); expected 510.9 (0.02) Passed Vit filter: 49 (0.00191818); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.19u 0.51s 00:00:01.70 Elapsed: 00:00:00.85 # Mc/sec: 1961.70 // Query: FtPinG0006588500.01.T01 [L=394] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-31 109.5 11.0 1e-31 109.5 11.0 1.9 2 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 109.5 11.0 4.1e-36 1e-31 1 74 [. 169 242 .. 169 243 .. 0.99 2 ? -2.8 0.3 0.46 1.2e+04 29 42 .. 379 392 .. 370 393 .. 0.75 Alignments for each domain: == domain 1 score: 109.5 bits; conditional E-value: 4.1e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv gC++dlss+k+yh+r+kvC +H+k+++vvv+g eqRfCqqCsrfh l eFd+ krsCr+rLa+hnerrrk FtPinG0006588500.01.T01 169 CQVYGCNKDLSSSKDYHKRQKVCDVHSKTAKVVVNGLEQRFCQQCSRFHLLGEFDDGKRSCRRRLAGHNERRRK 242 *************************************************************************8 PP == domain 2 score: -2.8 bits; conditional E-value: 0.46 SBP 29 aesvvvkgeeqRfC 42 ++v vk e+q fC FtPinG0006588500.01.T01 379 RQAVSVKQEDQTFC 392 46778888888888 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (394 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 956 (0.0374242); expected 510.9 (0.02) Passed bias filter: 549 (0.0214915); expected 510.9 (0.02) Passed Vit filter: 44 (0.00172245); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.55u 0.57s 00:00:02.12 Elapsed: 00:00:01.04 # Mc/sec: 1534.10 // Query: FtPinG0006650700.01.T01 [L=619] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-33 114.6 0.0 6.7e-33 113.7 0.0 1.5 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 1.4e-07 32.2 3.5 4.1e-07 30.7 3.5 1.8 1 SBP SBP domain Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.7 0.0 5.2e-37 6.7e-33 3 113 .] 247 361 .. 245 361 .. 0.93 Alignments for each domain: == domain 1 score: 113.7 bits; conditional E-value: 5.2e-37 Ig_SPL7 3 ekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslsee....dtvkdeeeelqklkfscsepnvlGrg 84 ++ap+l++V+P ++eagk++e+ v+Gsn+ qp++r l+sf+GkY+ + + + ++ + + +++l ++ ++++e+nv+G++ FtPinG0006650700.01.T01 247 KRAPQLHYVYPSFFEAGKPMEINVCGSNIFQPNFRSLVSFAGKYVDHTYNIAFPHDtldgEGSVSFDHQLCRILVPHTEANVYGPA 332 689*********************************************9998888555555566788******************* PP Ig_SPL7 85 FiEVEneglssnffPvivadkeiCsElrl 113 F+EVEne ++snf+P+i++++e+CsE+++ FtPinG0006650700.01.T01 333 FVEVENEFGLSNFIPIIIGNEELCSEMKM 361 ***************************97 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 30.7 3.5 3.2e-11 4.1e-07 48 75 .] 5 32 .. 2 32 .. 0.94 Alignments for each domain: == domain 1 score: 30.7 bits; conditional E-value: 3.2e-11 SBP 48 fhelseFdgekrsCrkrLakhnerrrkk 75 fh ls+Fd+ krsCr++L++hn+rrr+k FtPinG0006650700.01.T01 5 FHVLSDFDEGKRSCRRKLERHNKRRRRK 32 9************************985 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (619 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 770 (0.0301429); expected 510.9 (0.02) Passed bias filter: 657 (0.0257193); expected 510.9 (0.02) Passed Vit filter: 34 (0.00133098); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.35u 0.51s 00:00:01.86 Elapsed: 00:00:01.03 # Mc/sec: 2431.76 // Query: FtPinG0000377600.01.T01 [L=1003] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-39 132.5 0.2 1.8e-38 131.6 0.2 1.5 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 6.2e-30 103.8 15.3 1.2e-29 102.9 15.3 1.5 1 SBP SBP domain 0.0012 19.6 1.2 2 9.4 0.0 3.0 3 Ank Ankyrin repeat 0.003 18.6 0.0 0.02 16.0 0.0 2.2 1 Ank_2 Ankyrin repeats (3 copies) ------ inclusion threshold ------ 0.01 16.8 0.0 12 7.3 0.0 2.9 2 Ank_3 Ankyrin repeat 0.05 14.5 0.0 24 6.0 0.0 2.8 2 Ank_5 Ankyrin repeats (many copies) 0.24 12.3 0.1 59 4.7 0.0 3.0 3 Ank_4 Ankyrin repeats (many copies) 2.6 8.2 4.9 0.56 10.3 0.2 2.1 2 BNIP3 BNIP3 Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 131.6 0.2 5.7e-42 1.8e-38 3 112 .. 564 673 .. 562 674 .. 0.94 Alignments for each domain: == domain 1 score: 131.6 bits; conditional E-value: 5.7e-42 Ig_SPL7 3 ekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslsee.dtvkdeeeelqklkfscsepnvlGrgFiE 87 + ++++lsVsP+av++++ ++f +kGsnLs+p+trl+c++eGkYl qe ++++ + +++ +++e++ +++scs+p+v+GrgFiE FtPinG0000377600.01.T01 564 SYCSRILSVSPIAVSMSELAHFQIKGSNLSSPSTRLVCALEGKYLDQEEHQDATIDdNNLV-DDDEIEFVNLSCSIPSVTGRGFIE 648 6799********************************************9999988845555.57********************** PP Ig_SPL7 88 VEneglssnffPvivadkeiCsElr 112 VE++glss+ffP+iva+k++CsE+ FtPinG0000377600.01.T01 649 VEDHGLSSSFFPFIVAEKNVCSEIL 673 ***********************95 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 102.9 15.3 3.8e-33 1.2e-29 1 74 [. 142 215 .. 142 216 .. 0.99 Alignments for each domain: == domain 1 score: 102.9 bits; conditional E-value: 3.8e-33 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqvd+C+ dls+ak+yhrrhkvCe+H+k+++ ++ ++ qRfCqqCsrfh l+eFd+ krsCr+rLa+hn+rrrk FtPinG0000377600.01.T01 142 CQVDECGFDLSNAKDYHRRHKVCERHSKSTQALIGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNKRRRK 215 *************************************************************************8 PP >> Ank Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 7.7 0.0 0.0022 6.9 6 23 .. 778 795 .. 775 801 .. 0.88 2 ! 9.4 0.0 0.00063 2 2 21 .. 831 851 .. 830 859 .. 0.81 3 ? -3.5 0.1 8 2.5e+04 17 29 .. 975 987 .. 970 988 .. 0.55 Alignments for each domain: == domain 1 score: 7.7 bits; conditional E-value: 0.0022 Ank 6 LHlAaraghlevvklLLk 23 LH A+r+++ ++v+lLL+ FtPinG0000377600.01.T01 778 LHRAVRRNSRSLVELLLH 795 9*****9**********4 PP == domain 2 score: 9.4 bits; conditional E-value: 0.00063 Ank 2 GnTPLHlAa.raghlevvklL 21 G TPLH+Aa g++ v+ L FtPinG0000377600.01.T01 831 GLTPLHIAAgTDGSEAVLDAL 851 89*******866777777666 PP == domain 3 score: -3.5 bits; conditional E-value: 8 Ank 17 vvklLLkhG.Advn 29 +v LL +G dvn FtPinG0000377600.01.T01 975 CV-ALLFRGsPDVN 987 44.45535756666 PP >> Ank_2 Ankyrin repeats (3 copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.0 0.0 6.1e-06 0.02 1 77 [. 778 888 .. 746 896 .. 0.71 Alignments for each domain: == domain 1 score: 16.0 bits; conditional E-value: 6.1e-06 Ank_2 1 LmlAakngnlelvklLl.eg........................adanlqdk......ngetaLhlAaknghleiv.klLle.... 50 L+ A+++++ +lv+lLl + g t+Lh+Aa ++ e+v +L + FtPinG0000377600.01.T01 778 LHRAVRRNSRSLVELLLhYSrgkssgeseyshklhqnedghgflF------RpdkrgpAGLTPLHIAAGTDGSEAVlDALTDdpgk 857 799999998999999996224577777776655544444433332......04445559999999999966556654999986554 PP Ank_2 51 ..hgad..vn..dnngrtaLhyAaesghleivk 77 + n d++g ++ yA gh+ + FtPinG0000377600.01.T01 858 vgV--EawKNalDSTGSSPEDYARLRGHYTYIH 888 221..1334466688999999998888877665 PP >> Ank_3 Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 7.3 0.0 0.0039 12 5 23 .. 777 795 .. 774 799 .. 0.90 2 ? 6.1 0.0 0.0097 31 2 23 .. 831 853 .. 830 858 .. 0.82 Alignments for each domain: == domain 1 score: 7.3 bits; conditional E-value: 0.0039 Ank_3 5 pLhlAarngrleivklLle 23 +Lh A+r ++ +v+lLl FtPinG0000377600.01.T01 777 LLHRAVRRNSRSLVELLLH 795 8****************97 PP == domain 2 score: 6.1 bits; conditional E-value: 0.0097 Ank_3 2 gntpLhlAarngrle.ivklLle 23 g tpLh+Aa + e ++++L + FtPinG0000377600.01.T01 831 GLTPLHIAAGTDGSEaVLDALTD 853 88*******99999877887766 PP >> Ank_5 Ankyrin repeats (many copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 5.3 0.0 0.012 38 18 36 .. 776 794 .. 769 805 .. 0.85 2 ? 6.0 0.0 0.0074 24 7 32 .. 822 847 .. 818 852 .. 0.79 Alignments for each domain: == domain 1 score: 5.3 bits; conditional E-value: 0.012 Ank_5 18 tpLhvAakygaleivrlLl 36 Lh A+++++ +v+lLl FtPinG0000377600.01.T01 776 DLLHRAVRRNSRSLVELLL 794 67****************9 PP == domain 2 score: 6.0 bits; conditional E-value: 0.0074 Ank_5 7 adlnrldgegytpLhvAakygaleiv 32 +++ + g tpLh+Aa ++ +e v FtPinG0000377600.01.T01 822 FRPDKRGPAGLTPLHIAAGTDGSEAV 847 56677778899*******98887776 PP >> Ank_4 Ankyrin repeats (many copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 4.7 0.0 0.018 59 31 50 .] 775 794 .. 767 794 .. 0.90 2 ? 4.0 0.0 0.031 1e+02 23 39 .. 824 840 .. 815 852 .. 0.76 3 ? -2.9 0.0 4.6 1.5e+04 24 46 .. 865 887 .. 860 889 .. 0.79 Alignments for each domain: == domain 1 score: 4.7 bits; conditional E-value: 0.018 Ank_4 31 etaLhfAasngnlevlklLl 50 + Lh+A+++++ + ++lLl FtPinG0000377600.01.T01 775 MDLLHRAVRRNSRSLVELLL 794 568***************97 PP == domain 2 score: 4.0 bits; conditional E-value: 0.031 Ank_4 23 inat.dgngetaLhfAas 39 ++++ + g t+Lh+Aa FtPinG0000377600.01.T01 824 PDKRgPA-GLTPLHIAAG 840 6677665.********96 PP == domain 3 score: -2.9 bits; conditional E-value: 4.6 Ank_4 24 natdgngetaLhfAasngnlevl 46 na+d g ++ ++A ++g++ + FtPinG0000377600.01.T01 865 NALDSTGSSPEDYARLRGHYTYI 887 56678888899999999998766 PP >> BNIP3 BNIP3 # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.5 0.7 0.76 2.4e+03 36 77 .. 276 317 .. 197 352 .. 0.67 2 ? 10.3 0.2 0.00018 0.56 48 86 .. 417 455 .. 415 481 .. 0.82 Alignments for each domain: == domain 1 score: -1.5 bits; conditional E-value: 0.76 BNIP3 36 shngelerlLleAqreserSsskassesdspprpksPessqs 77 +++ L e q+ + S s+ +s+ spp ++ P+ + FtPinG0000377600.01.T01 276 QGVDDISGQLHEYQKLLNGSISVGNSANFSPPLSSPPPRPPR 317 344555555666666666665555555445555444433222 PP == domain 2 score: 10.3 bits; conditional E-value: 0.00018 BNIP3 48 AqreserSsskassesdspprpksPessqseedaleede 86 Aq++s++Ss + s +++ ++sP+ss s ed++ + FtPinG0000377600.01.T01 417 AQQDSQQSSPPQISGNSDSASAQSPPSSSSGEDQIRTGR 455 9*******9987777778899*********999876655 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (1003 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 865 (0.0338618); expected 510.9 (0.02) Passed bias filter: 689 (0.026972); expected 510.9 (0.02) Passed Vit filter: 70 (0.00274026); expected 25.5 (0.001) Passed Fwd filter: 8 (0.000313173); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 8 [number of targets reported over threshold] # CPU time: 1.47u 0.49s 00:00:01.96 Elapsed: 00:00:01.02 # Mc/sec: 4003.26 // Query: FtPinG0005349100.01.T01 [L=982] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.3e-38 129.3 0.1 1.8e-37 128.4 0.1 1.5 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 2.1e-31 108.5 12.7 4.4e-31 107.5 12.7 1.6 1 SBP SBP domain 1.8e-07 32.1 0.0 0.00067 20.7 0.0 2.0 2 Ank_2 Ankyrin repeats (3 copies) 0.00015 22.4 0.4 0.14 13.1 0.0 2.9 2 Ank Ankyrin repeat 0.0012 19.6 0.1 7.7 8.0 0.2 3.2 2 Ank_3 Ankyrin repeat ------ inclusion threshold ------ 0.19 12.7 0.5 27 5.8 0.0 3.1 3 Ank_5 Ankyrin repeats (many copies) Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 128.4 0.1 4.3e-41 1.8e-37 3 113 .] 555 665 .. 553 665 .. 0.96 Alignments for each domain: == domain 1 score: 128.4 bits; conditional E-value: 4.3e-41 Ig_SPL7 3 ekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslseedtvkdeeeelqklkfscsepnvlGrgFiEV 88 +++++ls +P+av+ +++++f +kG+nLs+++trllc++eGkYl e+ ++++++ + +ee++ +++ +sc +p+v GrgFiEV FtPinG0005349100.01.T01 555 YHCSRILSLTPIAVSISEPAHFQIKGFNLSRNSTRLLCALEGKYLNLEAHQDIIRDGNSLTEEDDNECVIMSCLIPSVAGRGFIEV 640 5899***************************************************96666678*********************** PP Ig_SPL7 89 EneglssnffPvivadkeiCsElrl 113 E++glss++fP+ivadk++CsE+r+ FtPinG0005349100.01.T01 641 EDNGLSSSSFPFIVADKDVCSEIRM 665 ***********************97 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.5 12.7 1e-34 4.4e-31 1 74 [. 141 214 .. 141 215 .. 0.99 Alignments for each domain: == domain 1 score: 107.5 bits; conditional E-value: 1e-34 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC+adls+ak+yhrrhkvC+ H+ka++ vv ++ qRfCqqCsrfh l+eFdg krsCr+rLa+hn+rrrk FtPinG0005349100.01.T01 141 CQVEGCGADLSDAKDYHRRHKVCQIHSKAAKAVVGNVMQRFCQQCSRFHVLQEFDGGKRSCRRRLAGHNNRRRK 214 *************************************************************************8 PP >> Ank_2 Ankyrin repeats (3 copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 18.5 0.0 7.3e-07 0.0031 27 82 .. 761 834 .. 735 846 .. 0.65 2 ! 20.7 0.0 1.6e-07 0.00067 1 77 [. 769 868 .. 769 876 .. 0.73 Alignments for each domain: == domain 1 score: 18.5 bits; conditional E-value: 7.3e-07 Ank_2 27 k..ngetaLhlAaknghleivklLle...hgad..........vndnn.......grtaLhyAaes.ghleivklLlek 82 ++ Lh A++++ +v+lLl + g t+Lh+Aa + g++ei+ L ++ FtPinG0005349100.01.T01 761 LalSEMGLLHRAVRRNCRALVELLLRyihV--SsseefngnylF---RpdlkgsaGLTPLHIAAGKdGSEEILDALTDD 834 14566779********9999*****94430..133333333441...04444555*********99999***9999853 PP == domain 2 score: 20.7 bits; conditional E-value: 1.6e-07 Ank_2 1 LmlAakngnlelvklLl..eg............adanlqdkngetaLhlAak.nghleivklLle......hgad..vn..dnngr 61 L+ A++++ lv+lLl + ++l+ + g t+Lh+Aa g++ei+ +L + + n d++g FtPinG0005349100.01.T01 769 LHRAVRRNCRALVELLLryIHvssseefngnylFRPDLKGSAGLTPLHIAAGkDGSEEILDALTDdpgkvgI--EawKNarDSTGS 852 899***9989999999975225666565555554456555599*****88884679999*****96654331..2444456899** PP Ank_2 62 taLhyAaesghleivk 77 t+ yA gh+ + FtPinG0005349100.01.T01 853 TPEDYARLRGHYTYIH 868 ******9999987765 PP >> Ank Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 6.2 0.2 0.0051 22 6 23 .. 769 786 .. 767 792 .. 0.88 2 ! 13.1 0.0 3.3e-05 0.14 2 22 .. 811 832 .. 810 842 .. 0.88 Alignments for each domain: == domain 1 score: 6.2 bits; conditional E-value: 0.0051 Ank 6 LHlAaraghlevvklLLk 23 LH A+r+++ +v+lLL+ FtPinG0005349100.01.T01 769 LHRAVRRNCRALVELLLR 786 9*****9**********4 PP == domain 2 score: 13.1 bits; conditional E-value: 3.3e-05 Ank 2 GnTPLHlAa.raghlevvklLL 22 G TPLH+Aa + g++e++ L FtPinG0005349100.01.T01 811 GLTPLHIAAgKDGSEEILDALT 832 89********9999***99885 PP >> Ank_3 Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 8.0 0.2 0.0018 7.7 5 25 .. 768 787 .. 766 791 .. 0.91 2 ! 7.8 0.0 0.002 8.6 2 23 .. 811 833 .. 810 839 .. 0.86 Alignments for each domain: == domain 1 score: 8.0 bits; conditional E-value: 0.0018 Ank_3 5 pLhlAarngrleivklLlekl 25 +Lh A+r ++ +v+lLl+ + FtPinG0005349100.01.T01 768 LLHRAVRRNCRALVELLLR-Y 787 7*****************9.4 PP == domain 2 score: 7.8 bits; conditional E-value: 0.002 Ank_3 2 gntpLhlAarngrle.ivklLle 23 g tpLh+Aa + e i+++L + FtPinG0005349100.01.T01 811 GLTPLHIAAGKDGSEeILDALTD 833 88*********999779999977 PP >> Ank_5 Ankyrin repeats (many copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 3.2 0.2 0.042 1.8e+02 20 36 .. 769 785 .. 759 789 .. 0.92 2 ? 5.8 0.0 0.0064 27 9 30 .. 804 825 .. 799 834 .. 0.78 3 ? -2.0 0.0 1.8 7.6e+03 43 56 .] 845 858 .. 844 858 .. 0.91 Alignments for each domain: == domain 1 score: 3.2 bits; conditional E-value: 0.042 Ank_5 20 LhvAakygaleivrlLl 36 Lh A+++++ +v+lLl FtPinG0005349100.01.T01 769 LHRAVRRNCRALVELLL 785 9***************9 PP == domain 2 score: 5.8 bits; conditional E-value: 0.0064 Ank_5 9 lnrldgegytpLhvAakygale 30 ++ + g tpLh+Aa ++ +e FtPinG0005349100.01.T01 804 PDLKGSAGLTPLHIAAGKDGSE 825 556677889*******976655 PP == domain 3 score: -2.0 bits; conditional E-value: 1.8 Ank_5 43 nlkdeegltpldlA 56 n++d+ g+tp d+A FtPinG0005349100.01.T01 845 NARDSTGSTPEDYA 858 89********9998 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (982 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 753 (0.0294774); expected 510.9 (0.02) Passed bias filter: 610 (0.0238794); expected 510.9 (0.02) Passed Vit filter: 52 (0.00203562); expected 25.5 (0.001) Passed Fwd filter: 6 (0.00023488); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 6 [number of targets reported over threshold] # CPU time: 1.87u 0.61s 00:00:02.48 Elapsed: 00:00:01.18 # Mc/sec: 3391.17 // Query: FtPinG0007448200.01.T01 [L=971] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.1e-40 136.1 0.1 1.4e-39 135.2 0.1 1.5 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 2.5e-30 105.1 13.7 6e-30 103.9 13.7 1.7 1 SBP SBP domain 7.7e-05 23.7 0.0 0.013 16.5 0.0 2.3 2 Ank_2 Ankyrin repeats (3 copies) 0.0002 22.0 0.2 2.8 9.3 0.0 4.4 4 Ank_3 Ankyrin repeat 0.0065 17.2 0.0 0.44 11.5 0.0 3.3 2 Ank Ankyrin repeat ------ inclusion threshold ------ 0.12 13.6 1.6 0.45 11.8 1.6 1.9 1 MRNIP MRN-interacting protein 0.14 12.7 0.4 0.36 11.4 0.4 1.7 1 zf-BED BED zinc finger Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 135.2 0.1 3.9e-43 1.4e-39 4 113 .] 541 650 .. 538 650 .. 0.94 Alignments for each domain: == domain 1 score: 135.2 bits; conditional E-value: 3.9e-43 Ig_SPL7 4 kapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslsee.dtvkdeeeelqklkfscsepnvlGrgFiEV 88 k ++++s+sPlav a+k v+fvv+G+nLsq+ +rllc+++GkYlv+e++++l e+ d+ e +++q+l+f+cs p++ GrgFiE+ FtPinG0007448200.01.T01 541 KNCQIVSISPLAVPASKAVQFVVRGYNLSQSMSRLLCALDGKYLVEESCSDLWEDaDQS-VETDNIQCLTFHCSTPKTAGRGFIEI 625 5679**************************************************95544.567*********************** PP Ig_SPL7 89 EneglssnffPvivadkeiCsElrl 113 E++g+s++ffP+ivad ++CsE+++ FtPinG0007448200.01.T01 626 EDSGMSGSFFPFIVADPDVCSEICT 650 ***********************96 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 103.9 13.7 1.6e-33 6e-30 1 74 [. 136 209 .. 136 210 .. 0.99 Alignments for each domain: == domain 1 score: 103.9 bits; conditional E-value: 1.6e-33 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv +C+adl+sak+yhrrhkvCe+H+ka++ +v + qRfCqqCsrfh l+eFd+ +rsCr+rLa+hn+rrrk FtPinG0007448200.01.T01 136 CQVVNCGADLASAKDYHRRHKVCEMHSKATQAIVGNLMQRFCQQCSRFHVLEEFDEGRRSCRRRLAGHNKRRRK 209 *************************************************************************8 PP >> Ank_2 Ankyrin repeats (3 copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 14.2 0.0 1.9e-05 0.069 19 82 .. 744 826 .. 727 832 .. 0.72 2 ! 16.5 0.0 3.6e-06 0.013 1 78 [. 759 861 .. 759 870 .. 0.67 Alignments for each domain: == domain 1 score: 14.2 bits; conditional E-value: 1.9e-05 Ank_2 19 gadanlqdk.ngetaLhlAaknghleivklLlehgadvn...dnn................grtaLhyAaes.ghleivklLlek 82 g+ + +++ +++ Lh+A+++++ +v Ll + + +n d + t+Lh+Aa s g ++++ Lle+ FtPinG0007448200.01.T01 744 GTYPSVKNAvEEMGLLHHAVRKNSRGLVVSLLRY-IPQNkqtD-YkqpdsfvfrpdamgpgSLTPLHVAATSpGFEDVLDALLED 826 455566666777889********99999999987.33333221.1355566777777778789********9***********64 PP == domain 2 score: 16.5 bits; conditional E-value: 3.6e-06 Ank_2 1 LmlAakngnlelvklLl....eg......adanlqdk............ngetaLhlAak.nghleivklLle....hgad..... 54 L++A+++++ lv Ll ++ + + t+Lh+Aa g ++++ +Lle FtPinG0007448200.01.T01 759 LHHAVRKNSRGLVVSLLryipQNkqtdykQ------PdsfvfrpdamgpGSLTPLHVAATsPGFEDVLDALLEdpgmV--Givawk 836 899999988888888886543223322220......1456666666665669****666626899*******955442..133443 PP Ank_2 55 vn.dnngrtaLhyAaesghleivkl 78 + d++g t+ yA++ gh+ ++l FtPinG0007448200.01.T01 837 TArDSTGLTPNDYASMRGHYSYINL 861 225899*************998884 PP >> Ank_3 Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.0 7 2.6e+04 4 12 .. 62 70 .. 61 72 .. 0.83 2 ? 5.7 0.0 0.012 42 5 25 .. 758 777 .. 755 782 .. 0.86 3 ! 9.3 0.0 0.00076 2.8 4 25 .. 805 827 .. 803 829 .. 0.88 4 ? 0.7 0.0 0.5 1.8e+03 2 18 .. 843 859 .. 842 862 .. 0.86 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 7 Ank_3 4 tpLhlAarn 12 +pL lAa+n FtPinG0007448200.01.T01 62 NPLDLAALN 70 7999**987 PP == domain 2 score: 5.7 bits; conditional E-value: 0.012 Ank_3 5 pLhlAarngrleivklLlekl 25 +Lh+A+r ++ +v Ll+ + FtPinG0007448200.01.T01 758 LLHHAVRKNSRGLVVSLLR-Y 777 8**********99999988.5 PP == domain 3 score: 9.3 bits; conditional E-value: 0.00076 Ank_3 4 tpLhlAarngrle.ivklLlekl 25 tpLh+Aa + +e ++++Lle + FtPinG0007448200.01.T01 805 TPLHVAATSPGFEdVLDALLEDP 827 9***********88******955 PP == domain 4 score: 0.7 bits; conditional E-value: 0.5 Ank_3 2 gntpLhlAarngrleiv 18 g tp +A + g++ ++ FtPinG0007448200.01.T01 843 GLTPNDYASMRGHYSYI 859 89***********9865 PP >> Ank Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 1.6 0.0 0.17 6.3e+02 6 22 .. 759 775 .. 757 785 .. 0.77 2 ! 11.5 0.0 0.00012 0.44 4 23 .. 805 825 .. 803 832 .. 0.89 Alignments for each domain: == domain 1 score: 1.6 bits; conditional E-value: 0.17 Ank 6 LHlAaraghlevvklLL 22 LH A+r+++ +v LL FtPinG0007448200.01.T01 759 LHHAVRKNSRGLVVSLL 775 9****878777887777 PP == domain 2 score: 11.5 bits; conditional E-value: 0.00012 Ank 4 TPLHlAa.raghlevvklLLk 23 TPLH+Aa + g ++v+ LL+ FtPinG0007448200.01.T01 805 TPLHVAAtSPGFEDVLDALLE 825 *******999**********5 PP >> MRNIP MRN-interacting protein # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.8 1.6 0.00012 0.45 9 33 .. 894 920 .. 891 927 .. 0.90 Alignments for each domain: == domain 1 score: 11.8 bits; conditional E-value: 0.00012 MRNIP 9 lfqvkqvkK..skkwkCkiCgekQslk 33 fq++ kK sk+w+C++C+ k s+ FtPinG0007448200.01.T01 894 SFQMEKLKKpcSKDWQCNVCERKFSYG 920 79*******999***********9875 PP >> zf-BED BED zinc finger # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.4 0.4 0.0001 0.36 13 33 .. 904 924 .. 897 928 .. 0.82 Alignments for each domain: == domain 1 score: 11.4 bits; conditional E-value: 0.0001 zf-BED 13 ketkakCryCgkilsrgggts 33 +++ ++C+ C++++s+g++ + FtPinG0007448200.01.T01 904 CSKDWQCNVCERKFSYGHTGT 924 6789************95543 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (971 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 950 (0.0371893); expected 510.9 (0.02) Passed bias filter: 707 (0.0276766); expected 510.9 (0.02) Passed Vit filter: 66 (0.00258368); expected 25.5 (0.001) Passed Fwd filter: 7 (0.000274026); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 7 [number of targets reported over threshold] # CPU time: 1.37u 0.47s 00:00:01.84 Elapsed: 00:00:00.90 # Mc/sec: 4378.32 // Query: FtPinG0003310800.01.T01 [L=121] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.2e-33 113.0 13.4 1.1e-32 112.6 13.4 1.2 1 SBP SBP domain ------ inclusion threshold ------ 0.041 14.4 0.0 0.1 13.1 0.0 1.7 2 HSD_C Homoserine dehydrogenase C-terminal domain 0.07 13.6 1.2 0.094 13.2 1.2 1.2 1 RAMP Receptor activity modifying family Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.6 13.4 1.3e-36 1.1e-32 1 74 [. 32 105 .. 32 106 .. 0.99 Alignments for each domain: == domain 1 score: 112.6 bits; conditional E-value: 1.3e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqvd+C+adl++ak+yhrrhkvCe H+k++ v+v g+++RfCqqCsrfhel eFd++krsCr+rLa+hnerrrk FtPinG0003310800.01.T01 32 CQVDKCTADLNEAKSYHRRHKVCEYHSKSSDVLVVGVHKRFCQQCSRFHELWEFDDTKRSCRRRLAGHNERRRK 105 *************************************************************************8 PP >> HSD_C Homoserine dehydrogenase C-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.3 0.0 0.4 3.4e+03 48 63 .. 7 24 .. 7 28 .. 0.68 2 ? 13.1 0.0 1.2e-05 0.1 14 51 .. 33 70 .. 19 76 .. 0.86 Alignments for each domain: == domain 1 score: -1.3 bits; conditional E-value: 0.4 HSD_C 48 GldesPekvle..ksGfe 63 G+++s e++ + k+G+ FtPinG0003310800.01.T01 7 GIESSSERLTTtkKKGYS 24 788888876542267876 PP == domain 2 score: 13.1 bits; conditional E-value: 1.2e-05 HSD_C 14 sveklenelkakLPlhksLkvverDaetaavvvvGlde 51 +v k +l ++ +h+ kv e+ ++++ v+vvG+ + FtPinG0003310800.01.T01 33 QVDKCTADLNEAKSYHRRHKVCEYHSKSSDVLVVGVHK 70 6788899999999**********************976 PP >> RAMP Receptor activity modifying family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.2 1.2 1.1e-05 0.094 25 75 .. 36 83 .. 14 91 .. 0.79 Alignments for each domain: == domain 1 score: 13.2 bits; conditional E-value: 1.1e-05 RAMP 25 kiirsYseltkCtekvaellglywPnklvekfflevHkkyFknCsleeeal 75 k +l++ +++ ++ + + +k ++ +++ vHk++ ++Cs +e + FtPinG0003310800.01.T01 36 K---CTADLNEAKSYHRRHKVCEYHSKSSDVLVVGVHKRFCQQCSRFHELW 83 3...33567777777888889************************977766 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (121 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 1260 (0.0493247); expected 510.9 (0.02) Passed bias filter: 467 (0.0182815); expected 510.9 (0.02) Passed Vit filter: 37 (0.00144842); expected 25.5 (0.001) Passed Fwd filter: 3 (0.00011744); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 1.19u 0.46s 00:00:01.65 Elapsed: 00:00:01.04 # Mc/sec: 470.43 // Query: FtPinG0000212200.01.T01 [L=407] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.5e-31 107.8 12.4 5.8e-31 107.1 12.4 1.4 1 SBP SBP domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.1 12.4 2.3e-35 5.8e-31 1 74 [. 157 230 .. 157 231 .. 0.99 Alignments for each domain: == domain 1 score: 107.1 bits; conditional E-value: 2.3e-35 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv gC++dlss k+y++rhkvC H+k+++v vkg+eqRfCqqCsrfh l+eFd+ krsCrkrLa+hnerrrk FtPinG0000212200.01.T01 157 CQVLGCNKDLSSFKDYYKRHKVCDAHTKTAKVFVKGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLANHNERRRK 230 *************************************************************************8 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (407 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 803 (0.0314347); expected 510.9 (0.02) Passed bias filter: 549 (0.0214915); expected 510.9 (0.02) Passed Vit filter: 30 (0.0011744); expected 25.5 (0.001) Passed Fwd filter: 1 (3.91466e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 1.15u 0.47s 00:00:01.62 Elapsed: 00:00:00.93 # Mc/sec: 1766.94 // Query: FtPinG0000286400.01.T01 [L=225] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.7e-32 111.4 14.5 3.9e-32 110.9 14.5 1.2 1 SBP SBP domain ------ inclusion threshold ------ 1.8 9.9 7.6 0.14 13.5 3.2 1.5 2 Rrn6_K-rich RRN6, K-rich C-terminal domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 110.9 14.5 3.1e-36 3.9e-32 1 74 [. 89 162 .. 89 163 .. 0.99 Alignments for each domain: == domain 1 score: 110.9 bits; conditional E-value: 3.1e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq++gC+adls+ak+yhrrhkvCe H+ka++vv+ g +qRfCqqCsrfh l+eFd+ krsCr+rLa+hn+rrrk FtPinG0000286400.01.T01 89 CQAEGCNADLSNAKHYHRRHKVCEFHSKAATVVAGGLTQRFCQQCSRFHLLTEFDNGKRSCRRRLADHNRRRRK 162 *************************************************************************8 PP >> Rrn6_K-rich RRN6, K-rich C-terminal domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -3.8 0.1 2 2.6e+04 84 91 .. 10 17 .. 5 36 .. 0.51 2 ? 13.5 3.2 1.1e-05 0.14 33 95 .. 150 216 .. 99 223 .. 0.64 Alignments for each domain: == domain 1 score: -3.8 bits; conditional E-value: 2 Rrn6_K-rich 84 sssptlpd 91 s spt+p+ FtPinG0000286400.01.T01 10 SFSPTAPS 17 33333333 PP == domain 2 score: 13.5 bits; conditional E-value: 1.1e-05 Rrn6_K-rich 33 rqrsrrkeekrrkrkerlkaaseaeaskssessqssqsesssasssslasssssptlpd.....afsl 95 r+r +++++rrk+ ++ +a s++++s+ + +s s++s++ s ss ++a+ss+ + a+s+ FtPinG0000286400.01.T01 150 RRRLADHNRRRRKSHQT-TAGSHDRRSENPPRSPSESSRAHSISSVTVAVSSPMEDSIPtcynsAPSP 216 55555555555554444.77888888877777777766666665555555554433222366443333 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (225 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 871 (0.0340967); expected 510.9 (0.02) Passed bias filter: 460 (0.0180074); expected 510.9 (0.02) Passed Vit filter: 36 (0.00140928); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.92u 0.44s 00:00:01.36 Elapsed: 00:00:00.77 # Mc/sec: 1177.11 // Query: FtPinG0001287900.01.T01 [L=184] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.2e-32 112.5 14.2 1.7e-32 112.0 14.2 1.2 1 SBP SBP domain ------ inclusion threshold ------ 0.12 11.4 0.5 0.16 11.1 0.5 1.0 1 DUF4487 Domain of unknown function (DUF4487) Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 112.0 14.2 1.4e-36 1.7e-32 1 74 [. 51 124 .. 51 125 .. 0.99 Alignments for each domain: == domain 1 score: 112.0 bits; conditional E-value: 1.4e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq+d C a l++ak+yhrrhkvCe Haka++v+v+g++qRfCqqCsrfhelseFd++krsCr+rLa+hnerrrk FtPinG0001287900.01.T01 51 CQADSCPAVLTEAKRYHRRHKVCEFHAKAAVVTVAGIRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRK 124 *************************************************************************8 PP >> DUF4487 Domain of unknown function (DUF4487) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 11.1 0.5 1.2e-05 0.16 64 105 .. 60 101 .. 50 102 .. 0.92 Alignments for each domain: == domain 1 score: 11.1 bits; conditional E-value: 1.2e-05 DUF4487 64 steaklFqktfklcrFflnnlvhyikefksflskvckeihql 105 teak +++ k+c F + +v +++ + c+++h+l FtPinG0001287900.01.T01 60 LTEAKRYHRRHKVCEFHAKAAVVTVAGIRQRFCQQCSRFHEL 101 79**************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (184 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 713 (0.0279115); expected 510.9 (0.02) Passed bias filter: 407 (0.0159327); expected 510.9 (0.02) Passed Vit filter: 34 (0.00133098); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.88u 0.35s 00:00:01.23 Elapsed: 00:00:00.84 # Mc/sec: 886.17 // Query: FtPinG0002293500.01.T01 [L=100] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.2e-34 117.2 14.2 5.1e-34 116.9 14.2 1.1 1 SBP SBP domain ------ inclusion threshold ------ 0.059 12.5 0.7 0.071 12.2 0.7 1.0 1 DUF4487 Domain of unknown function (DUF4487) 0.15 12.2 0.2 0.16 12.1 0.2 1.0 1 Per1 Per1-like family Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 116.9 14.2 6e-38 5.1e-34 1 74 [. 15 88 .. 15 89 .. 0.99 Alignments for each domain: == domain 1 score: 116.9 bits; conditional E-value: 6e-38 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq+++C+adl++ak+yhrrhkvCe Haka++v+v+g++qRfCqqCsrfhe+seFd+ krsCr+rLa+hnerrr+ FtPinG0002293500.01.T01 15 CQAENCTADLTDAKRYHRRHKVCEFHAKAPVVIVSGIQQRFCQQCSRFHEISEFDDMKRSCRRRLAGHNERRRR 88 ************************************************************************98 PP >> DUF4487 Domain of unknown function (DUF4487) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.2 0.7 8.4e-06 0.071 61 105 .. 21 65 .. 8 66 .. 0.89 Alignments for each domain: == domain 1 score: 12.2 bits; conditional E-value: 8.4e-06 DUF4487 61 aissteaklFqktfklcrFflnnlvhyikefksflskvckeihql 105 ++ t+ak +++ k+c F + v +++ + + c+++h++ FtPinG0002293500.01.T01 21 TADLTDAKRYHRRHKVCEFHAKAPVVIVSGIQQRFCQQCSRFHEI 65 6778***************************************86 PP >> Per1 Per1-like family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.1 0.2 1.9e-05 0.16 18 81 .. 19 84 .. 9 98 .. 0.77 Alignments for each domain: == domain 1 score: 12.1 bits; conditional E-value: 1.9e-05 Per1 18 qCqheitee.rekegeevvqfhGKWpFlrvlgiqEpaSvlfSllnllahlkgl.kklkkevkkklp 81 +C+ ++t++ r ++ ++v fh K p + v giq + S + + ++ + ++++++++ +++ FtPinG0002293500.01.T01 19 NCTADLTDAkRYHRRHKVCEFHAKAPVVIVSGIQQRFCQQCSRFHEISEFDDMkRSCRRRLAGHNE 84 5888877751556678**********************9999999999999884555555554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (100 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 1166 (0.0456449); expected 510.9 (0.02) Passed bias filter: 499 (0.0195342); expected 510.9 (0.02) Passed Vit filter: 34 (0.00133098); expected 25.5 (0.001) Passed Fwd filter: 3 (0.00011744); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 1.06u 0.42s 00:00:01.48 Elapsed: 00:00:00.92 # Mc/sec: 439.48 // Query: FtPinG0001874600.01.T01 [L=63] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-12 47.6 3.1 3e-12 47.2 3.1 1.2 1 SBP SBP domain ------ inclusion threshold ------ 0.12 12.9 1.0 0.19 12.2 1.0 1.3 1 Tachystatin_B Antimicrobial chitin binding protein tachystat Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 47.2 3.1 2.3e-16 3e-12 1 43 [. 21 63 .] 21 63 .] 0.99 Alignments for each domain: == domain 1 score: 47.2 bits; conditional E-value: 2.3e-16 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCq 43 C v +C+ d+s+ k+yh rhkvCe H+k+++v+++g+eq fCq FtPinG0001874600.01.T01 21 CLVYECKSDFSKYKDYHIRHKVCELHSKTPKVTIAGREQHFCQ 63 99****************************************9 PP >> Tachystatin_B Antimicrobial chitin binding protein tachystatin B # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.2 1.0 1.5e-05 0.19 10 29 .. 8 30 .. 5 33 .. 0.82 Alignments for each domain: == domain 1 score: 12.2 bits; conditional E-value: 1.5e-05 Tachystatin_B 10 rCrvysGrs...CCfGyyCrrdf 29 r rv sG CC+ y C+ df FtPinG0001874600.01.T01 8 RVRVASGGNqvvCCLVYECKSDF 30 899999964444**********9 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (63 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 852 (0.0333529); expected 510.9 (0.02) Passed bias filter: 456 (0.0178509); expected 510.9 (0.02) Passed Vit filter: 27 (0.00105696); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 0.94u 0.44s 00:00:01.38 Elapsed: 00:00:00.91 # Mc/sec: 280.05 // Query: FtPinG0003446200.01.T01 [L=689] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.8e-37 127.3 1.2 1e-36 126.0 1.2 1.8 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 1.1e-28 99.8 15.1 2.5e-28 98.7 15.1 1.6 1 SBP SBP domain ------ inclusion threshold ------ 0.013 15.7 3.1 0.013 15.7 3.1 2.3 2 Zn_ribbon_NUD NADH pyrophosphatase zinc ribbon domain 2.4 8.6 5.3 1.5 9.2 2.2 2.3 2 DZR_2 Double zinc ribbon domain Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 126.0 1.2 1.6e-40 1e-36 2 113 .] 317 432 .. 316 432 .. 0.93 Alignments for each domain: == domain 1 score: 126.0 bits; conditional E-value: 1.6e-40 Ig_SPL7 2 eekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslsee....dtvkdeeeelqklkfscsepnvlGr 83 +++ap++++V+P ++eagk++ef+v+G nL qp++r l+sf+GkYl +e + + s+e ++ + ++++ +++++c+e+++ G+ FtPinG0003446200.01.T01 317 TKQAPKIHYVQPSCFEAGKPMEFIVCGNNLFQPNFRSLVSFAGKYLDHEFSVAFSSEkidsEASVSFSHQFCRIRVPCTETQFNGP 402 689***********************************************999988655444555667****************** PP Ig_SPL7 84 gFiEVEneglssnffPvivadkeiCsElrl 113 +FiE+En +++snf+P+i++d+++CsE+++ FtPinG0003446200.01.T01 403 AFIEIENMSGLSNFIPIIICDDQVCSEIKM 432 ****************************97 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 98.7 15.1 3.9e-32 2.5e-28 1 75 [] 28 102 .. 28 102 .. 0.99 Alignments for each domain: == domain 1 score: 98.7 bits; conditional E-value: 3.9e-32 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrkk 75 Cqv++C+ad+s++k yhrrh+vC ++a+a+sv+++ge +R+CqqC++fhels+Fd+ krsCr++L++hn+rrr+k FtPinG0003446200.01.T01 28 CQVTDCKADISELKGYHRRHRVCLRCANATSVLIDGESKRYCQQCGKFHELSDFDEGKRSCRRKLERHNNRRRRK 102 ************************************************************************985 PP >> Zn_ribbon_NUD NADH pyrophosphatase zinc ribbon domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 15.7 3.1 2e-06 0.013 1 31 [. 45 76 .. 45 76 .. 0.89 2 ? -2.1 1.1 0.75 4.8e+03 2 6 .. 384 388 .. 384 388 .. 0.93 Alignments for each domain: == domain 1 score: 15.7 bits; conditional E-value: 2e-06 Zn_ribbon_NUD 1 rthrFCgrCGapt.vpaeggwarvCpsCgleh 31 r+hr C rC+ +t v+++g+ +r C +Cg h FtPinG0003446200.01.T01 45 RRHRVCLRCANATsVLIDGESKRYCQQCGKFH 76 89********99846799**********9765 PP == domain 2 score: -2.1 bits; conditional E-value: 0.75 Zn_ribbon_NUD 2 thrFC 6 +h+FC FtPinG0003446200.01.T01 384 SHQFC 388 7**** PP >> DZR_2 Double zinc ribbon domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.2 2.2 0.00023 1.5 18 52 .. 44 88 .. 31 92 .. 0.73 2 ? -2.1 0.1 0.77 4.9e+03 35 47 .. 326 338 .. 321 344 .. 0.79 Alignments for each domain: == domain 1 score: 9.2 bits; conditional E-value: 0.00023 DZR_2 18 aeegalCaaCrkelef.i...eeplCkrcGkp..l....eegelC 52 ++++++C +C++ ++ i ++++C++cGk l e++++C FtPinG0003446200.01.T01 44 HRRHRVCLRCANATSVlIdgeSKRYCQQCGKFheLsdfdEGKRSC 88 578999*****99988568888899*****963312333334666 PP == domain 2 score: -2.1 bits; conditional E-value: 0.77 DZR_2 35 eeplCkrcGkple 47 +p C Gkp+e FtPinG0003446200.01.T01 326 VQPSCFEAGKPME 338 6799999999975 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (689 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 728 (0.0284987); expected 510.9 (0.02) Passed bias filter: 527 (0.0206303); expected 510.9 (0.02) Passed Vit filter: 42 (0.00164416); expected 25.5 (0.001) Passed Fwd filter: 4 (0.000156586); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 4 [number of targets reported over threshold] # CPU time: 1.34u 0.48s 00:00:01.82 Elapsed: 00:00:01.08 # Mc/sec: 2587.83 // Query: FtPinG0006144300.01.T01 [L=110] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.4e-33 113.9 14.4 5.2e-33 113.7 14.4 1.1 1 SBP SBP domain ------ inclusion threshold ------ 0.045 14.1 0.0 0.045 14.1 0.0 1.1 1 CNH CNH domain 0.12 12.6 0.3 0.12 12.5 0.3 1.0 1 Per1 Per1-like family Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 113.7 14.4 6.1e-37 5.2e-33 1 74 [. 17 90 .. 17 91 .. 0.99 Alignments for each domain: == domain 1 score: 113.7 bits; conditional E-value: 6.1e-37 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq+++C+ dl++ak+yh+rhkvCe Haka++v+v+g++qRfCqqCsrfhe+ eFd++krsCr+rLa+hnerrr+ FtPinG0006144300.01.T01 17 CQAENCTSDLTEAKRYHQRHKVCEFHAKAPVVIVAGIQQRFCQQCSRFHEVLEFDDTKRSCRRRLAGHNERRRR 90 ************************************************************************98 PP >> CNH CNH domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 14.1 0.0 5.3e-06 0.045 114 155 .. 32 73 .. 9 104 .. 0.80 Alignments for each domain: == domain 1 score: 14.1 bits; conditional E-value: 5.3e-06 CNH 114 lkkfkkfkefqlpsevvsiellksklcvgsakgfeivsldsl 155 +++++k++ef+++++vv+++ +++++c + ++ e++ +d + FtPinG0006144300.01.T01 32 YHQRHKVCEFHAKAPVVIVAGIQQRFCQQCSRFHEVLEFDDT 73 6899********************************999883 PP >> Per1 Per1-like family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 12.5 0.3 1.5e-05 0.12 18 80 .. 21 85 .. 9 105 .. 0.72 Alignments for each domain: == domain 1 score: 12.5 bits; conditional E-value: 1.5e-05 Per1 18 qCqheite.erekegeevvqfhGKWpFlrvlgiqEpaSvlfSllnllahlkgl.kklkkevkkkl 80 +C+ ++te +r ++ ++v fh K p + v giq + S + + ++ ++++++++ ++ FtPinG0006144300.01.T01 21 NCTSDLTEaKRYHQRHKVCEFHAKAPVVIVAGIQQRFCQQCSRFHEVLEFDDTkRSCRRRLAGHN 85 4666655516667778*******************999999998888888877345555554444 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (110 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 974 (0.0381288); expected 510.9 (0.02) Passed bias filter: 461 (0.0180466); expected 510.9 (0.02) Passed Vit filter: 44 (0.00172245); expected 25.5 (0.001) Passed Fwd filter: 3 (0.00011744); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 1.05u 0.42s 00:00:01.47 Elapsed: 00:00:00.92 # Mc/sec: 483.48 // Query: FtPinG0006382900.01.T01 [L=398] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-32 111.9 11.0 2.9e-32 111.3 11.0 1.3 1 SBP SBP domain ------ inclusion threshold ------ 0.043 14.3 0.5 0.078 13.4 0.5 1.4 1 Mob_synth_C Molybdenum Cofactor Synthesis C Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 111.3 11.0 2.2e-36 2.9e-32 1 74 [. 164 237 .. 164 238 .. 0.99 Alignments for each domain: == domain 1 score: 111.3 bits; conditional E-value: 2.2e-36 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv gC++dlss+k y++rhkvCe+H+k+++v+vkg+eqRfCqqCsrfh l+eFd+ krsCrkrLa+hnerrrk FtPinG0006382900.01.T01 164 CQVYGCSKDLSSSKGYYKRHKVCEDHTKTAVVIVKGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAHHNERRRK 237 *************************************************************************8 PP >> Mob_synth_C Molybdenum Cofactor Synthesis C # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.4 0.5 6.1e-06 0.078 40 81 .. 171 214 .. 148 218 .. 0.72 Alignments for each domain: == domain 1 score: 13.4 bits; conditional E-value: 6.1e-06 Mob_synth_C 40 eakketggpakryki..kdgkgeiglIapvsenFCasCnRlRlt 81 ++ ++++g kr+k+ + +k+ + +++ +++ FC++C+R l FtPinG0006382900.01.T01 171 KDLSSSKGYYKRHKVceDHTKTAVVIVKGIEQRFCQQCSRFHLL 214 444555666667776534445789****************9775 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (398 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 626 (0.0245058); expected 510.9 (0.02) Passed bias filter: 472 (0.0184772); expected 510.9 (0.02) Passed Vit filter: 34 (0.00133098); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.16u 0.49s 00:00:01.65 Elapsed: 00:00:00.93 # Mc/sec: 1733.71 // Query: FtPinG0006337300.01.T01 [L=99] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-33 114.3 15.2 4e-33 114.0 15.2 1.1 1 SBP SBP domain 0.0097 16.2 0.0 0.0098 16.2 0.0 1.1 1 CNH CNH domain ------ inclusion threshold ------ 0.025 13.7 1.3 0.03 13.4 1.3 1.0 1 DUF4487 Domain of unknown function (DUF4487) Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 114.0 15.2 4.7e-37 4e-33 1 74 [. 14 87 .. 14 88 .. 0.99 Alignments for each domain: == domain 1 score: 114.0 bits; conditional E-value: 4.7e-37 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq+++C+adl++ak+yhrrhkvCe Haka++v+v+ +qRfCqqCsrfhelseFd++krsCr+rLa+hnerrr+ FtPinG0006337300.01.T01 14 CQAENCTADLTDAKRYHRRHKVCEFHAKAPVVIVATLQQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRR 87 ************************************************************************98 PP >> CNH CNH domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.2 0.0 1.1e-06 0.0098 105 154 .. 11 69 .. 2 94 .. 0.78 Alignments for each domain: == domain 1 score: 16.2 bits; conditional E-value: 1.1e-06 CNH 105 ikllewnep.........lkkfkkfkefqlpsevvsiellksklcvgsakgfeivslds 154 i++++ ++ ++ ++k++ef+++++vv++++l++++c + ++ e+ +d FtPinG0006337300.01.T01 11 IVCCQAENCtadltdakrYHRRHKVCEFHAKAPVVIVATLQQRFCQQCSRFHELSEFDD 69 5555555446666666668899****************************999766655 PP >> DUF4487 Domain of unknown function (DUF4487) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 13.4 1.3 3.6e-06 0.03 61 105 .. 20 64 .. 7 65 .. 0.87 Alignments for each domain: == domain 1 score: 13.4 bits; conditional E-value: 3.6e-06 DUF4487 61 aissteaklFqktfklcrFflnnlvhyikefksflskvckeihql 105 ++ t+ak +++ k+c F + v +++ ++ + c+++h+l FtPinG0006337300.01.T01 20 TADLTDAKRYHRRHKVCEFHAKAPVVIVATLQQRFCQQCSRFHEL 64 5678***************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (99 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 1343 (0.0525739); expected 510.9 (0.02) Passed bias filter: 468 (0.0183206); expected 510.9 (0.02) Passed Vit filter: 36 (0.00140928); expected 25.5 (0.001) Passed Fwd filter: 3 (0.00011744); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 3 [number of targets reported over threshold] # CPU time: 1.03u 0.41s 00:00:01.44 Elapsed: 00:00:00.93 # Mc/sec: 431.15 // Query: FtPinG0007464600.01.T01 [L=991] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-38 130.8 0.2 7.2e-38 129.7 0.2 1.6 1 Ig_SPL7 SPL7-like, immunoglobulin-like domain 2.8e-31 108.1 14.5 5.7e-31 107.1 14.5 1.6 1 SBP SBP domain 0.003 18.6 0.0 0.011 16.7 0.0 2.1 1 Ank_2 Ankyrin repeats (3 copies) 0.0041 17.9 0.1 2 9.4 0.0 2.9 2 Ank Ankyrin repeat ------ inclusion threshold ------ 0.016 16.2 0.1 23 6.5 0.0 3.5 4 Ank_3 Ankyrin repeat Domain annotation for each model (and alignments): >> Ig_SPL7 SPL7-like, immunoglobulin-like domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 129.7 0.2 1.4e-41 7.2e-38 3 113 .] 571 681 .. 569 681 .. 0.95 Alignments for each domain: == domain 1 score: 129.7 bits; conditional E-value: 1.4e-41 Ig_SPL7 3 ekapellsVsPlaveagkevefvvkGsnLsqpktrllcsfeGkYlvqevteslseedtvkdeeeelqklkfscsepnvlGrgFiEV 88 ++++++lsV+P+av ++ ++f +kGsnLs+++trllc++eGkYl+ e ++l++++++ +++++++ +scs+p+v+GrgFiE+ FtPinG0007464600.01.T01 571 SCCSRILSVTPVAVPISELAQFQIKGSNLSRSSTRLLCALEGKYLSLEPHQDLITDENTLIGDNDIECVALSCSIPSVTGRGFIEI 656 6799**************************************************996666668*********************** PP Ig_SPL7 89 EneglssnffPvivadkeiCsElrl 113 E++glss+f+P+iva+k++CsE+r+ FtPinG0007464600.01.T01 657 EDHGLSSSFVPFIVAEKDVCSEIRM 681 ***********************97 PP >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.1 14.5 1.1e-34 5.7e-31 1 74 [. 148 221 .. 148 222 .. 0.99 Alignments for each domain: == domain 1 score: 107.1 bits; conditional E-value: 1.1e-34 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cqv+gC+adls+ak+yhrrhkvCe H+ka++ +v+++ qRfCqqCsrfh+l+eFd+ krsCr+rLa+hn+rrrk FtPinG0007464600.01.T01 148 CQVEGCGADLSTAKDYHRRHKVCELHSKATHALVANVMQRFCQQCSRFHALQEFDEGKRSCRRRLAGHNKRRRK 221 *************************************************************************8 PP >> Ank_2 Ankyrin repeats (3 copies) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 16.7 0.0 2.2e-06 0.011 1 84 [. 785 890 .. 755 895 .. 0.75 Alignments for each domain: == domain 1 score: 16.7 bits; conditional E-value: 2.2e-06 Ank_2 1 LmlAakngnlelvklLl.eg.............adanlqdkngetaLhlAak.nghleivklLle......hgad..vn..dnngr 61 L+ A++++ lv+lLl + ++++ + g t+Lh+Aa g++ ++ +L + + n d +g FtPinG0007464600.01.T01 785 LHRAVRRNGRALVELLLrYVpvsssqdlsrnflFRPDVKGPAGLTPLHIAAGiDGSEAVLDALTDdpgkvgI--EawKNaqDATGS 868 899***755789****96224555555555554445555559******999945565556999996654330..2443455799** PP Ank_2 62 taLhyAaesghleivklLlekga 84 t+ y+ gh+ ++ L+ek++ FtPinG0007464600.01.T01 869 TPEDYSRLRGHYTYIR-LIEKKI 890 ***9999999999998.555555 PP >> Ank Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 5.1 0.0 0.0096 49 6 23 .. 785 802 .. 783 810 .. 0.88 2 ! 9.4 0.0 0.0004 2 2 21 .. 827 847 .. 826 856 .. 0.82 Alignments for each domain: == domain 1 score: 5.1 bits; conditional E-value: 0.0096 Ank 6 LHlAaraghlevvklLLk 23 LH A+r++ +v+lLL+ FtPinG0007464600.01.T01 785 LHRAVRRNGRALVELLLR 802 9****9999********4 PP == domain 2 score: 9.4 bits; conditional E-value: 0.0004 Ank 2 GnTPLHlAa.raghlevvklL 21 G TPLH+Aa g++ v+ L FtPinG0007464600.01.T01 827 GLTPLHIAAgIDGSEAVLDAL 847 89*******876877777766 PP >> Ank_3 Ankyrin repeat # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -4.0 0.0 5 2.6e+04 9 23 .. 301 315 .. 296 317 .. 0.82 2 ? -3.8 0.0 5 2.6e+04 9 23 .. 746 760 .. 741 763 .. 0.75 3 ? 5.4 0.0 0.011 54 5 23 .. 784 802 .. 782 807 .. 0.90 4 ? 6.5 0.0 0.0045 23 2 23 .. 827 849 .. 826 855 .. 0.83 Alignments for each domain: == domain 1 score: -4.0 bits; conditional E-value: 5 Ank_3 9 AarngrleivklLle 23 A++ g+ e + +Ll FtPinG0007464600.01.T01 301 AISEGSSEKISALLS 315 888999999999986 PP == domain 2 score: -3.8 bits; conditional E-value: 5 Ank_3 9 AarngrleivklLle 23 + ++ + +vk Ll+ FtPinG0007464600.01.T01 746 SIDHDWCAVVKKLLD 760 567778889999987 PP == domain 3 score: 5.4 bits; conditional E-value: 0.011 Ank_3 5 pLhlAarngrleivklLle 23 +Lh A+r + +v+lLl+ FtPinG0007464600.01.T01 784 LLHRAVRRNGRALVELLLR 802 7*****************9 PP == domain 4 score: 6.5 bits; conditional E-value: 0.0045 Ank_3 2 gntpLhlAarngrle.ivklLle 23 g tpLh+Aa + e ++++L + FtPinG0007464600.01.T01 827 GLTPLHIAAGIDGSEaVLDALTD 849 88*******99999878888866 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (991 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 836 (0.0327266); expected 510.9 (0.02) Passed bias filter: 669 (0.0261891); expected 510.9 (0.02) Passed Vit filter: 57 (0.00223136); expected 25.5 (0.001) Passed Fwd filter: 5 (0.000195733); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 5 [number of targets reported over threshold] # CPU time: 1.78u 0.60s 00:00:02.38 Elapsed: 00:00:00.98 # Mc/sec: 4092.14 // Query: FtPinG0005035600.01.T01 [L=267] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-31 107.9 15.6 4.6e-31 107.4 15.6 1.2 1 SBP SBP domain ------ inclusion threshold ------ 4.6 7.1 7.0 6.2 6.7 7.0 1.2 1 AFF4_CHD AFF4, C-terminal homology domain Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 107.4 15.6 3.6e-35 4.6e-31 1 74 [. 133 206 .. 133 207 .. 0.99 Alignments for each domain: == domain 1 score: 107.4 bits; conditional E-value: 3.6e-35 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhelseFdgekrsCrkrLakhnerrrk 74 Cq++gC +dl++ak+yhrrhkvCe H+ka++vv++g +qRfCqqCsrfh lseFd+ krsCr+rLa+hn+rrrk FtPinG0005035600.01.T01 133 CQAEGCFVDLTHAKHYHRRHKVCELHSKASTVVTSGLTQRFCQQCSRFHVLSEFDNGKRSCRRRLADHNRRRRK 206 *************************************************************************8 PP >> AFF4_CHD AFF4, C-terminal homology domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 6.7 7.0 0.00049 6.2 129 190 .. 194 261 .. 157 265 .. 0.65 Alignments for each domain: == domain 1 score: 6.7 bits; conditional E-value: 0.00049 AFF4_CHD 129 srtLtehfknsskvaqapspvva..kstgtpsplspkpspassvssqsss......vgssgvsssvsipq 190 r L +h + k+ q + ++ s + p p++ +ps + +vs+ s ++ss++sssvs+p FtPinG0005035600.01.T01 194 RRRLADHNRRRRKSHQLATATQNssCSDNPPTPIPESPSNSGAVSE--MSpdsncyNNSSAASSSVSTPS 261 4789999998888888877776622334444555444444444443..2223467888899999***997 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (267 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 1137 (0.0445097); expected 510.9 (0.02) Passed bias filter: 578 (0.0226267); expected 510.9 (0.02) Passed Vit filter: 43 (0.0016833); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.00u 0.37s 00:00:01.37 Elapsed: 00:00:00.83 # Mc/sec: 1301.88 // Query: FtPinG0009904300.01.T01 [L=123] Scores for complete sequence (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Model Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.2e-18 66.3 7.3 5.1e-18 65.6 7.3 1.3 1 SBP SBP domain ------ inclusion threshold ------ 8.5 7.1 9.2 2.2 9.0 3.8 2.4 2 Ribosomal_L32p Ribosomal L32p protein family Domain annotation for each model (and alignments): >> SBP SBP domain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 65.6 7.3 4e-22 5.1e-18 1 50 [. 40 89 .. 40 94 .. 0.95 Alignments for each domain: == domain 1 score: 65.6 bits; conditional E-value: 4e-22 SBP 1 CqvdgCeadlssakeyhrrhkvCeeHakaesvvvkgeeqRfCqqCsrfhe 50 C vdgC+ dl+s +eyhrrh+vCe+H+k+++v+v geeqRfCqqCsr+ + FtPinG0009904300.01.T01 40 CLVDGCTWDLNSCREYHRRHRVCERHSKTPVVLVGGEEQRFCQQCSRYYK 89 9*********************************************9765 PP >> Ribosomal_L32p Ribosomal L32p protein family # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? 9.0 3.8 0.00018 2.2 31 44 .. 51 64 .. 26 72 .. 0.88 2 ? 0.6 0.2 0.075 9.5e+02 40 49 .. 79 89 .. 77 94 .. 0.65 Alignments for each domain: == domain 1 score: 9.0 bits; conditional E-value: 0.00018 Ribosomal_L32p 31 ncgelklpHrvcps 44 +c+e++++Hrvc + FtPinG0009904300.01.T01 51 SCREYHRRHRVCER 64 7***********76 PP == domain 2 score: 0.6 bits; conditional E-value: 0.075 Ribosomal_L32p 40 rvcpsc.GyYk 49 r c +c yYk FtPinG0009904300.01.T01 79 RFCQQCsRYYK 89 56777744666 PP Internal pipeline statistics summary: ------------------------------------- Query sequence(s): 1 (123 residues searched) Target model(s): 25545 (4079224 nodes) Passed MSV filter: 976 (0.0382071); expected 510.9 (0.02) Passed bias filter: 456 (0.0178509); expected 510.9 (0.02) Passed Vit filter: 39 (0.00152672); expected 25.5 (0.001) Passed Fwd filter: 2 (7.82932e-05); expected 0.3 (1e-05) Initial search space (Z): 25545 [actual number of targets] Domain search space (domZ): 2 [number of targets reported over threshold] # CPU time: 1.09u 0.44s 00:00:01.53 Elapsed: 00:00:00.89 # Mc/sec: 560.96 // [ok]