43 lines
1.8 KiB
Plaintext
Executable File
43 lines
1.8 KiB
Plaintext
Executable File
# Genetic Code Table
|
|
#
|
|
# Obtained from: http://www3.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi
|
|
#
|
|
# Version 3.6
|
|
# Added code 22 TAG-Leu, TCA-stop
|
|
# found in mitochondrial DNA of Scenedesmus obliquus
|
|
# submitted by Gertraude Berger, Ph.D.
|
|
# Organelle Genome Megasequencing Program, Univ Montreal
|
|
#
|
|
# Other Alternative Initiation Codons
|
|
#
|
|
# GUG, UUG (and possibly CUG) in the Archaea (Noelling et al., unpublished)
|
|
# AUA, GUG, UUG, and AUC or AAG may be used (at least in experimental
|
|
# systems) by the yeasts Saccharomyces cerevisiae (Olsen, 1987, and references
|
|
# therein).
|
|
#
|
|
# ACG initiates translation of certain proteins in the adeno-associated virus
|
|
# type 2 (Becerra et al., 1985), the phage T7 mutant CR17 (Anderson and
|
|
# Buzash-Pollert, 1985), Sendai virus (Gupta and Patwardhan, 1988), and rice
|
|
# chloroplast (Hiratsuka et al., 1989). Also, it is the most effective non-AUG
|
|
# initiation codon in mammalin cells (Koepke and Leggatt, 1991).
|
|
#
|
|
# CUG is the initiation codon for one of the two alternative products of the
|
|
# human c-myc gene (Hann et al., 1987).
|
|
#
|
|
# Systematic Range:
|
|
#
|
|
# Scenedesmus obliquus: Nedelcu A, Lee RW, Lemieux C, Gray MW and Burger G.
|
|
# "The complete mitochondrial DNA sequence of Scenedesmus obliquus reflects an
|
|
# intermediate stage in the evolution of the green algal mitochondrial genome."
|
|
# Genome Research (in press).
|
|
|
|
Genetic Code [22]
|
|
|
|
Scenedesmus obliquus Mitochondrial
|
|
|
|
AAs = FFLLSS*SYY*LCC*WLLLLPPPPHHQQRRRRIIIMTTTTNNKKSSRRVVVVAAAADDEEGGGG
|
|
Starts = -----------------------------------M----------------------------
|
|
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
|
|
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
|
|
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
|