71 lines
2.3 KiB
Plaintext
Executable File
71 lines
2.3 KiB
Plaintext
Executable File
# Genetic Code Table
|
|
#
|
|
# Obtained from: http://www3.ncbi.nlm.nih.gov/Taxonomy/Utils/wprintgc.cgi
|
|
#
|
|
# Version 3.3 - 10/13/95
|
|
# Added alternate intiation codon ATC to code 5
|
|
# based on complete mitochondrial genome of honeybee
|
|
# Crozier and Crozier (1993)
|
|
#
|
|
# Version 3.2 - 6/24/95
|
|
# GTG allowed as alternate initiator
|
|
#
|
|
# Comment:
|
|
#
|
|
# The codon AGG is absent in Drosophila.
|
|
#
|
|
# Differences from the Standard Code:
|
|
#
|
|
#
|
|
# Code 5 Standard
|
|
#
|
|
# AGA Ser S Arg R
|
|
# AGG Ser S Arg R
|
|
# AUA Met M Ile I
|
|
# UGA Trp W Ter *
|
|
#
|
|
#
|
|
# Alternative Initiation Codons:
|
|
#
|
|
# AUA, AUU
|
|
# AUC: Apis (Crozier and Crozier, 1993)
|
|
# GUG: Polyplacophora (Boore and Brown, 1994 GenBank Accession Number: U09810)
|
|
# UUG: Ascaris, Caenorhabditis
|
|
#
|
|
# Systematic Range:
|
|
#
|
|
# Nematoda: Ascaris, Caenorhabditis;
|
|
# Mollusca: Bivalvia (Hoffmann et al., 1992); Polyplacophora (Boore and
|
|
# Brown, 1994)
|
|
# Arthropoda/Crustacea: Artemia (Batuecas et al., 1988);
|
|
# Arthropoda/Insecta: Drosophila [Locusta migratoria (migratory locust),
|
|
# Apis mellifera (honeybee)]
|
|
#
|
|
# Comments:
|
|
#
|
|
# GUG may possibly function as an initiator in Drosophila (Clary and
|
|
# Wolstenholme, 1985; Gadaleta et al., 1988). AUU is not used as an
|
|
# initiator in Mytilus (Hoffmann et al., 1992).
|
|
#
|
|
# "An exceptional mechanism must operate for initiation of translation of
|
|
# the cytochrome oxidase subunit I mRNA in both D. melanogaster (de
|
|
# Bruijn, 1983) and D. yakuba (Clary and Wolstenholme 1983), since its
|
|
# only plausible initiation codon, AUA, is out of frame with the rest of
|
|
# the gene. Initiation appears to require the "reading" of of an AUAA
|
|
# quadruplet, which would be equivalent to initiation at AUA followed
|
|
# immediately by a specific ribosomal frameshift. Another possible
|
|
# mechanism ... is that the mRNA is "edited" to bring the AUA initiation
|
|
# into frame." (Fox, 1987)
|
|
|
|
Genetic Code [5]
|
|
|
|
Invertebrate Mitochondrial
|
|
|
|
AAs = FFLLSSSSYY**CCWWLLLLPPPPHHQQRRRRIIMMTTTTNNKKSSSSVVVVAAAADDEEGGGG
|
|
Starts = ---M----------------------------MMMM---------------M------------
|
|
Base1 = TTTTTTTTTTTTTTTTCCCCCCCCCCCCCCCCAAAAAAAAAAAAAAAAGGGGGGGGGGGGGGGG
|
|
Base2 = TTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGGTTTTCCCCAAAAGGGG
|
|
Base3 = TCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAGTCAG
|
|
|
|
|